PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.E00311.1.p
Common NameLOC105966198, MIMGU_mgv1a008281mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family G2-like
Protein Properties Length: 380aa    MW: 41890.1 Da    PI: 6.8331
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.E00311.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.59.3e-31210265156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k r++W+peLH+rF++ ++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Migut.E00311.1.p 210 KSRRCWSPELHRRFLQSLQQLGGSHLATPKQIRELMKVDGLTNDEVKSHLQKYRLH 265
                       68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-27207268IPR009057Homeodomain-like
PROSITE profilePS5129413.088207267IPR017930Myb domain
SuperFamilySSF466891.03E-17208268IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-26210265IPR006447Myb domain, plants
PfamPF002492.6E-6212263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MSSINGHNHS DYSEKMQRCQ DYVHGLEQER SKIQVFQREL PLCLELVTQA IEACKQQLHG  60
QLSECSEQTS SDVVPVLEEF IPIKRAFSSF HSDEDDEEEE EQESKKLKND DDSSNKKSDW  120
LRSVQLWNNQ TPDLSKEDSP RKVAVTEVKR NGGGGAFHPF KKEKSTTTTT VAVVAAPPQE  180
GSMPPASTSS TAETGGGNKK EDKESQSQRK SRRCWSPELH RRFLQSLQQL GGSHLATPKQ  240
IRELMKVDGL TNDEVKSHLQ KYRLHTRRPN NQSMQNNNNN NQQAPQFVVV GGIWMQPEYA  300
TPMAAATTTS GEAASGVANS TGIYAPVASL PPPFHHASKQ RQHISDNDRG CSHSDGGVHS  360
NSPATSSSTH TSTASPAIY*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012846219.10.0PREDICTED: uncharacterized protein LOC105966198
TrEMBLA0A022QMP60.0A0A022QMP6_ERYGU; Uncharacterized protein
STRINGVIT_01s0011g03110.t011e-138(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.14e-76G2-like family protein